PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04489.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 336aa    MW: 36760 Da    PI: 6.0521
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04489.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.51.4e-08436436
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
               + C+ +++  ++l+C+ +  +lC +C ++ H  
  PK04489.1  4 KLCDSCKSATATLYCRADAAFLCVTCDSNVHAA 36
               68***************************9955 PP

2zf-B_box28.23.9e-094691342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  PK04489.1 46 VWVCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPI 91
               689*****************************66899999*99997 PP

3CCT69.96.4e-24278321144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  PK04489.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.1E-13148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.409142IPR000315B-box-type zinc finger
PfamPF006436.0E-6435IPR000315B-box-type zinc finger
CDDcd000218.05E-9548No hitNo description
PROSITE profilePS5011910.9934491IPR000315B-box-type zinc finger
PfamPF006431.2E-74691IPR000315B-box-type zinc finger
CDDcd000212.11E-94791No hitNo description
SMARTSM003362.8E-114991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787278320IPR010402CCT domain
PfamPF062034.9E-18278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRA DAAFLCVTCD SNVHAANKLA SLHARVWVCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLARRHERVP ITPLYESLNT AKSNGGGGGD GGAVNFLNDR  120
YFPEDAAEPN QTTAEVSTEE AEAASWLLPN PKAMESPDLN SGQYVFPDMV PYLDLDYGHL  180
DPKLEAQEQN SSGTDGVVPV HSNKSSQSQP PMANEQCYEI DFSGSNKHFL YNLSHSVSSS  240
SLDVGVVPDG PNGVEICENN KPMGSNGPQA AQFSSADREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TEVEIEAERY GVVPMF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222404.11e-157hypothetical protein PRUPE_ppa008143mg
SwissprotQ940T91e-127COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLB5THI21e-157B5THI2_PRUPE; CONSTANS-like protein
STRINGPOPTR_0018s03110.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-123CONSTANS-like 4